PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA53G01339
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 359aa    MW: 41402.4 Da    PI: 5.8619
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA53G01339genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.17.5e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W++eEde+l+ +++ +G g+W+ ++++ g+ R++k+c++rw +yl
       AA53G01339 14 RGLWSPEEDEKLITYITTHGYGCWSEVPEKAGLQRCGKSCRLRWINYL 61
                     788*******************************************97 PP

2Myb_DNA-binding51.62.2e-1667111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr+++eE++l++ ++   G++ W+ Ia++++ gRt++++k++w+++
       AA53G01339  67 RGRFSPEEEKLIISLHGVVGNR-WAHIASHLP-GRTDNEIKNYWNSW 111
                      89********************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.609.2E-25664IPR009057Homeodomain-like
PROSITE profilePS5129416.838961IPR017930Myb domain
SuperFamilySSF466891.61E-2911108IPR009057Homeodomain-like
SMARTSM007175.2E-121363IPR001005SANT/Myb domain
PfamPF002498.5E-151461IPR001005SANT/Myb domain
CDDcd001672.79E-101761No hitNo description
PROSITE profilePS5129425.2762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2565116IPR009057Homeodomain-like
SMARTSM007173.9E-1666114IPR001005SANT/Myb domain
PfamPF002494.2E-1567111IPR001005SANT/Myb domain
CDDcd001677.55E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:1901430Biological Processpositive regulation of syringal lignin biosynthetic process
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 359 aa     Download sequence    Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLITYIT THGYGCWSEV PEKAGLQRCG KSCRLRWINY  60
LRPDIRRGRF SPEEEKLIIS LHGVVGNRWA HIASHLPGRT DNEIKNYWNS WIKKKIRKTH  120
HHYNRHQPSN ITTVVTLNTN TTTSSTLVDN TNNLRFHGFI NDSSNSNQLN FTNTNTNNQE  180
TNFKIQENTL FIPDTTTTTL PVLQGMFSQT IITDNNNKID NQETQRGSRR SCDEQTFLST  240
NTTEEWDHMN NQEFHQVPSH LFNDTLESNM ETTLNYNVDN IVPIENSEVQ DNGEMASSFE  300
SLRRQELSYE QWIDSQQCSS GFLFWDNINI NDQGTSLSLV EEEPNSSINL GSSSFPSSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF2141161e-132AF214116.2 Arabidopsis thaliana putative transcription factor (MYB103) mRNA, complete cds.
GenBankAY5195641e-132AY519564.1 Arabidopsis thaliana MYB transcription factor (At1g63910) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006301440.11e-161hypothetical protein CARUB_v10021858mg
SwissprotQ8LPH66e-67MYB86_ARATH; Transcription factor MYB86
TrEMBLR0ICG11e-161R0ICG1_9BRAS; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_20000721e-156(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM87602539
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63910.11e-137myb domain protein 103